PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010915440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MIKC_MADS
Protein Properties Length: 268aa    MW: 31286.5 Da    PI: 9.6051
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010915440.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.11.8e-314392150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  XP_010915440.1 43 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 92
                    79***********************************************8 PP

2K-box112.34.8e-371112074100
           K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                     s++ s++ea+++++qqe++kL+++i +Lq+++R+l+Ge+L+s+s ++L+qLe +Lek+++kiR+kKnell+++ie++qk+e elq++n++Lr+k+
  XP_010915440.1 111 SNSGSVSEADSQYYQQESTKLRQQIISLQNSNRNLMGESLGSMSPRDLKQLEGRLEKGINKIRTKKNELLFAEIEYMQKREVELQNANMYLRNKI 205
                     444559****************************************************************************************9 PP

           K-box  99 ee 100
                     +e
  XP_010915440.1 206 AE 207
                     86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-423594IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.1323595IPR002100Transcription factor, MADS-box
CDDcd002655.44E-4436104No hitNo description
SuperFamilySSF554555.1E-3336107IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003791IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-333757IPR002100Transcription factor, MADS-box
PfamPF003191.1E-264491IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-335772IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-337293IPR002100Transcription factor, MADS-box
PfamPF014863.5E-28118205IPR002487Transcription factor, K-box
PROSITE profilePS5129715.631121211IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MIISPSRSQF HPLIRLWCEG RRSQEVAALE RPEKMGRGKI EIKRIENTTN RQVTFCKRRN  60
GLLKKAYELS VLCDAEVALI VFSSRGRLYE YANNSVKATI ERYKRACTDT SNSGSVSEAD  120
SQYYQQESTK LRQQIISLQN SNRNLMGESL GSMSPRDLKQ LEGRLEKGIN KIRTKKNELL  180
FAEIEYMQKR EVELQNANMY LRNKIAENER AQQQMNMLPQ TTEYEVMAPY DSRNFLQVNL  240
MQSNQHYSHQ QQTTLQLGYE PSLYYQIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-2135103169Myocyte-specific enhancer factor 2B
1tqe_Q4e-2135103169Myocyte-specific enhancer factor 2B
1tqe_R4e-2135103169Myocyte-specific enhancer factor 2B
1tqe_S4e-2135103169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915440.10.0PREDICTED: MADS-box transcription factor 3 isoform X1
SwissprotQ407041e-125MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLQ2NNC31e-162Q2NNC3_ELAGV; MADS box transcription factor
STRINGGSMUA_Achr10P21480_0011e-135(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-115MIKC_MADS family protein